PDB entry 3p48

View 3p48 on RCSB PDB site
Description: Structure of the yeast dUTPase DUT1 in complex with dUMPNPP
Class: hydrolase
Keywords: TRIMER, BETA BARREL, DUMPPNP PYROPHOSPHATASE, HYDROLASE, PHOSPHOPROTEIN, Structural Genomics, Ontario Centre for Structural Proteomics, OCSP
Deposited on 2010-10-06, released 2010-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.156
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, YBR252W, YBR1705
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p48a_
  • Chain 'B':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, YBR252W, YBR1705
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p48b_
  • Chain 'C':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DUT1, YBR252W, YBR1705
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p48c_
  • Heterogens: DUP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p48A (A:)
    mtatsdkvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvg
    tygriaprsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlileki
    vddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p48A (A:)
    kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p48B (B:)
    mtatsdkvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvg
    tygriaprsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlileki
    vddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p48B (B:)
    kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
    prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
    vvvdsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p48C (C:)
    mtatsdkvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvg
    tygriaprsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlileki
    vddaqivvvdsleesargaggfgstgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p48C (C:)
    dkvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygri
    aprsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaq
    ivvvdsle