PDB entry 3p3z

View 3p3z on RCSB PDB site
Description: Crystal Structure of the Cytochrome P450 Monooxygenase AurH from Streptomyces Thioluteus in Complex with Ancymidol
Class: oxidoreductase
Keywords: Cytochrome P450 Monooxygenase, Oxidation from deoxyaureothin to aureothin, OXIDOREDUCTASE
Deposited on 2010-10-05, released 2011-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: STREPTOMYCES THIOLUTEUS [TaxId:66431]
    Gene: aurH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70KH6 (10-415)
      • expression tag (9)
    Domains in SCOPe 2.06: d3p3za1, d3p3za2
  • Heterogens: HEM, P3Z, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p3zA (A:)
    isefdsegsnmsttahtepswadlpfldftdpnfswdspevaearekswiartplallvl
    ryaeadqlardkrlisgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpft
    prritavqpfvrstveqlidklpqgdfdfvqhfphplpalvmcqllgfpledydtvgrls
    ietnlglalsndqdilvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvldd
    yelrtlvatvlvagyettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptl
    pvtatrvaaedfevngvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgg
    gphfclgtalarlelteavaalatrldppqiageitwrhelgvagpdalplrfgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3zA (A:)
    nmsttahtepswadlpfldftdpnfswdspevaearekswiartplallvlryaeadqla
    rdkrlisgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpftprritavqp
    fvrstveqlidklpqgdfdfvqhfphplpalvmcqllgfpledydtvgrlsietnlglal
    sndqdilvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvlddyelrtlvat
    vlvagyettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptlpvtatrvaa
    edfevngvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgggphfclgta
    larlelteavaalatrldppqiageitwrhelgvagpdalplrfgaa