PDB entry 3p3x

View 3p3x on RCSB PDB site
Description: Crystal Structure of the Cytochrome P450 Monooxygenase AurH (nterm-AurH-I) from Streptomyces Thioluteus
Class: oxidoreductase
Keywords: Cytochrome P450 Monooxygenase, Oxidation of Deoxyaureothin to Aureothin, OXIDOREDUCTASE
Deposited on 2010-10-05, released 2011-02-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: STREPTOMYCES THIOLUTEUS [TaxId:66431]
    Gene: aurH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p3xa_
  • Chain 'B':
    Compound: cytochrome p450
    Species: STREPTOMYCES THIOLUTEUS [TaxId:66431]
    Gene: aurH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p3xb_
  • Heterogens: HEM, GOL, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p3xA (A:)
    isefdsegsnmsttahtepswadlpfldftdpnfswdspevaearekswiartplallvl
    ryaeadqlardkrlisgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpft
    prritavqpfvrstveqlidklpqgdfdfvqhfphplpalvmcqllgfpledydtvgrls
    ietnlglalsndqdilvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvldd
    yelrtlvatvlvagyettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptl
    pvtatrvaaedfevngvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgg
    gphfclgtalarlelteavaalatrldppqiageitwrhelgvagpdalplrfgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3xA (A:)
    epswadlpfldftdpnfswdspevaearekswiartplallvlryaeadqlardkrlisg
    frglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpftprritavqpfvrstveq
    lidklpqgdfdfvqhfphplpalvmcqllgfpledydtvgrlsietnlglalsndqdilv
    kveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvlddyelrtlvatvlvagyet
    tnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptlpvtatrvaaedfevngv
    riptgtpvfmcahvahrdprvfadadrfditvkreapsiafgggphfclgtalarlelte
    avaalatrldppqiageitwrhelgvagpdalplrfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p3xB (B:)
    isefdsegsnmsttahtepswadlpfldftdpnfswdspevaearekswiartplallvl
    ryaeadqlardkrlisgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpft
    prritavqpfvrstveqlidklpqgdfdfvqhfphplpalvmcqllgfpledydtvgrls
    ietnlglalsndqdilvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvldd
    yelrtlvatvlvagyettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptl
    pvtatrvaaedfevngvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgg
    gphfclgtalarlelteavaalatrldppqiageitwrhelgvagpdalplrfgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3xB (B:)
    htepswadlpfldftdpnfswdspevaearekswiartplallvlryaeadqlardkrli
    sgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpftprritavqpfvrstv
    eqlidklpqgdfdfvqhfphplpalvmcqllgfpledydtvgrlsietnlglalsndqdi
    lvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvlddyelrtlvatvlvagy
    ettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptlpvtatrvaaedfevn
    gvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgggphfclgtalarlel
    teavaalatrldppqiageitwrhelgvagpdalplrfg