PDB entry 3p3o

View 3p3o on RCSB PDB site
Description: Crystal Structure of the Cytochrome P450 Monooxygenase AurH (ntermII) from Streptomyces Thioluteus
Class: oxidoreductase
Keywords: Cytochrome P450, Monooxygenase, OXIDOREDUCTASE
Deposited on 2010-10-05, released 2011-02-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.158
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: STREPTOMYCES THIOLUTEUS [TaxId:66431]
    Gene: aurH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70KH6 (10-415)
      • expression tag (0-9)
    Domains in SCOPe 2.03: d3p3oa_
  • Heterogens: HEM, GOL, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p3oA (A:)
    isefdsegsnmsttahtepswadlpfldftdpnfswdspevaearekswiartplallvl
    ryaeadqlardkrlisgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpft
    prritavqpfvrstveqlidklpqgdfdfvqhfphplpalvmcqllgfpledydtvgrls
    ietnlglalsndqdilvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvldd
    yelrtlvatvlvagyettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptl
    pvtatrvaaedfevngvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgg
    gphfclgtalarlelteavaalatrldppqiageitwrhelgvagpdalplrfgaa