PDB entry 3p3m

View 3p3m on RCSB PDB site
Description: Gamma-subunit of the translation initiation factor 2 from S. solfataricus complexed with GTP
Class: translation
Keywords: translation
Deposited on 2010-10-05, released 2011-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p3ma1, d3p3ma2, d3p3ma3
  • Chain 'B':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p3mb1, d3p3mb2, d3p3mb3
  • Chain 'C':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p3mc1, d3p3mc2, d3p3mc3
  • Chain 'D':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p3md1, d3p3md2, d3p3md3
  • Chain 'E':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p3me1, d3p3me2, d3p3me3
  • Chain 'F':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p3mf1, d3p3mf2, d3p3mf3
  • Heterogens: GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p3mA (A:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3mA (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p3mB (B:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3mB (B:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p3mC (C:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3mC (C:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p3mD (D:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3mD (D:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3p3mE (E:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3mE (E:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3p3mF (F:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3mF (F:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei