PDB entry 3p3l

View 3p3l on RCSB PDB site
Description: Crystal Structure of the Cytochrome P450 monooxygenase AurH (wildtype) from Streptomyces Thioluteus
Class: oxidoreductase
Keywords: Cytochrome P450, Monooxygenase, OXIDOREDUCTASE
Deposited on 2010-10-05, released 2011-02-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: STREPTOMYCES THIOLUTEUS [TaxId:66431]
    Gene: aurH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70KH6 (Start-405)
      • conflict (143)
    Domains in SCOPe 2.03: d3p3la_
  • Chain 'B':
    Compound: cytochrome p450
    Species: STREPTOMYCES THIOLUTEUS [TaxId:66431]
    Gene: aurH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70KH6 (Start-405)
      • conflict (143)
    Domains in SCOPe 2.03: d3p3lb_
  • Heterogens: HEM, SO4, EPE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p3lA (A:)
    msttahtepswadlpfldftdpnfswdspevaearekswiartplallvlryaeadqlar
    dkrlisgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpftprritavqpf
    vrstveqlidklpqgdfdfvqhfahplpalvmcqllgfpledydtvgrlsietnlglals
    ndqdilvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvlddyelrtlvatv
    lvagyettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptlpvtatrvaae
    dfevngvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgggphfclgtal
    arlelteavaalatrldppqiageitwrhelgvagpdalplrfgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3lA (A:)
    tahtepswadlpfldftdpnfswdspevaearekswiartplallvlryaeadqlardkr
    lisgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpftprritavqpfvrs
    tveqlidklpqgdfdfvqhfahplpalvmcqllgfpledydtvgrlsietnlglalsndq
    dilvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvlddyelrtlvatvlva
    gyettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptlpvtatrvaaedfe
    vngvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgggphfclgtalarl
    elteavaalatrldppqiageitwrhelgvagpdalplrfgaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p3lB (B:)
    msttahtepswadlpfldftdpnfswdspevaearekswiartplallvlryaeadqlar
    dkrlisgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpftprritavqpf
    vrstveqlidklpqgdfdfvqhfahplpalvmcqllgfpledydtvgrlsietnlglals
    ndqdilvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvlddyelrtlvatv
    lvagyettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptlpvtatrvaae
    dfevngvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgggphfclgtal
    arlelteavaalatrldppqiageitwrhelgvagpdalplrfgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3lB (B:)
    tahtepswadlpfldftdpnfswdspevaearekswiartplallvlryaeadqlardkr
    lisgfrglvdmvgtpegpvrdfmvdflqsldgadhrrlrglathpftprritavqpfvrs
    tveqlidklpqgdfdfvqhfahplpalvmcqllgfpledydtvgrlsietnlglalsndq
    dilvkveqglgrmfdylvaaiekrkvepgddltsdivrafhdgvlddyelrtlvatvlva
    gyettnhqlalamydfaqhpdqwmkikenpelapqaveevlrwsptlpvtatrvaaedfe
    vngvriptgtpvfmcahvahrdprvfadadrfditvkreapsiafgggphfclgtalarl
    elteavaalatrldppqiageitwrhelgvagpdalplrfgaa