PDB entry 3p3k

View 3p3k on RCSB PDB site
Description: The crystal structure of translationally controlled tumor protein (TCTP) of Plasmodium falciparum
Class: metal binding protein
Keywords: Mainly Beta, METAL BINDING PROTEIN
Deposited on 2010-10-05, released 2011-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translationally-controlled tumor protein homolog
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: TCTP, PFE0545c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I3Z5 (4-174)
      • expression tag (0-3)
      • expression tag (175-181)
    Domains in SCOPe 2.08: d3p3ka1, d3p3ka2, d3p3ka3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p3kA (A:)
    mefrmkvfkdvftndevcsdsyvqqdpfevpefreiafevksnkrikgnedygiadnsed
    avegmgadvehvidivdsfqltstafskkeysayiknymqkvakyleekkpdrveifktk
    aqpfikhiltnfddfefymgesldmeagiiysyykgeeitprfvyisdglfeekylehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3kA (A:)
    mefrmkvfkdvftndevcsdsyvqqdpfevpefreiafevksnkrikhvidivdsfqlts
    tafskkeysayiknymqkvakyleekkpdrveifktkaqpfikhiltnfddfefymgesl
    dmeagiiysyykgeeitprfvyisdglfeekylehhhhh