PDB entry 3p2t

View 3p2t on RCSB PDB site
Description: Crystal Structure of Leukocyte Ig-like Receptor LILRB4 (ILT3/LIR-5/CD85k)
Class: Immune System
Keywords: LILR, IG, Inhibitory receptor, disulfide, Immune System
Deposited on 2010-10-04, released 2011-03-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leukocyte immunoglobulin-like receptor subfamily B member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: LILRB4, ILT3, LIR5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NHJ6
      • engineered mutation (132)
      • engineered mutation (142)
    Domains in SCOPe 2.04: d3p2ta1, d3p2ta2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p2tA (A:)
    gplpkptlwaepgsviswgnsvtiwcqgtleareyrldkeespapwdrqnplepknkarf
    sipsmtedyagryrcyyrspvgwsqpsdplelvmtgayskptlsalpsplvtsgksvtll
    cqsrspmdtfllckeraahpllclrsehgaqqhqaefpmspvtsvhggtyrcfsshgfsh
    yllshpsdplelivsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p2tA (A:)
    plpkptlwaepgsviswgnsvtiwcqgtleareyrldkeespapwdrqnplepknkarfs
    ipsmtedyagryrcyyrspvgwsqpsdplelvmtgayskptlsalpsplvtsgksvtllc
    qsrspmdtfllckeraahpllclrsehgaqqhqaefpmspvtsvhggtyrcfsshgfshy
    llshpsdplelivs