PDB entry 3p2o

View 3p2o on RCSB PDB site
Description: Crystal Structure of FolD Bifunctional Protein from Campylobacter jejuni
Class: oxidoreductase, hydrolase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta-alpha sandwich, hydrolase, cytosol, OXIDOREDUCTASE
Deposited on 2010-10-03, released 2010-10-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.193
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein folD
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: Cj0855, folD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PA35 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d3p2oa1, d3p2oa2
  • Chain 'B':
    Compound: Bifunctional protein folD
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: Cj0855, folD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PA35 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.05: d3p2ob1, d3p2ob2
  • Heterogens: NAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p2oA (A:)
    snamtlldgkalsakikeelkeknqflkskgiesclavilvgdnpasqtyvkskakacee
    cgikslvyhlnenitqnellalintlnhddsvhgilvqlplpdhickdlilesiisskdv
    dgfhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatml
    lnagatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgk
    ivgdvdfeevskkssyitpvpggvgpmtiamllentvksaknrln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p2oA (A:)
    snamtlldgkalsakikeelkeknqflkskgiesclavilvgdnpasqtyvkskakacee
    cgikslvyhlnenitqnellalintlnhddsvhgilvqlplpdhickdlilesiisskdv
    dgfhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatml
    lnagatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgk
    ivgdvdfeevskkssyitpvpggvgpmtiamllentvksaknrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p2oB (B:)
    snamtlldgkalsakikeelkeknqflkskgiesclavilvgdnpasqtyvkskakacee
    cgikslvyhlnenitqnellalintlnhddsvhgilvqlplpdhickdlilesiisskdv
    dgfhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatml
    lnagatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgk
    ivgdvdfeevskkssyitpvpggvgpmtiamllentvksaknrln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p2oB (B:)
    amtlldgkalsakikeelkeknqflkskgiesclavilvgdnpasqtyvkskakaceecg
    ikslvyhlnenitqnellalintlnhddsvhgilvqlplpdhickdlilesiisskdvdg
    fhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatmlln
    agatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgkiv
    gdvdfeevskkssyitpvpggvgpmtiamllentvksaknrl