PDB entry 3p2l

View 3p2l on RCSB PDB site
Description: Crystal Structure of ATP-dependent Clp protease subunit P from Francisella tularensis
Class: hydrolase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta half sandwich, protease, chaperon, cytosol, HYDROLASE
Deposited on 2010-10-02, released 2010-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.188
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: clpP, FTT_0624
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p2la_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: clpP, FTT_0624
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p2lb_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: clpP, FTT_0624
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p2lc_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: clpP, FTT_0624
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p2ld_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: clpP, FTT_0624
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p2le_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: clpP, FTT_0624
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p2lf_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: clpP, FTT_0624
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p2lg_
  • Heterogens: MG, PEG, GOL, EDO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p2lA (A:)
    snannlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p2lA (A:)
    nlvptviekrafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyins
    pggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqpl
    ggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakaygli
    dhviesrea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p2lB (B:)
    snannlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p2lB (B:)
    lvptviafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggm
    vtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggfr
    gqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvi
    esre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p2lC (C:)
    snannlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p2lC (C:)
    vptvfdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggmvta
    gmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggfrgqa
    sdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhviesr
    eai
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p2lD (D:)
    snannlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p2lD (D:)
    lvptvieerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinsp
    ggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplg
    gfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglid
    hviesrea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3p2lE (E:)
    snannlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p2lE (E:)
    vptvfdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggmvta
    gmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggfrgqa
    sdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhviesr
    ea
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3p2lF (F:)
    snannlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p2lF (F:)
    vptvifdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggmvt
    agmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggfrgq
    asdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvies
    rea
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3p2lG (G:)
    snannlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p2lG (G:)
    lvptvirafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspgg
    mvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggf
    rgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhv
    iesrea