PDB entry 3p1t

View 3p1t on RCSB PDB site
Description: Crystal structure of a putative aminotransferase (BPSL1724) from Burkholderia pseudomallei K96243 at 2.60 A resolution
Class: transferase
Keywords: plp-dependent transferase-like, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-biology, transferase
Deposited on 2010-09-30, released 2010-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative histidinol-phosphate aminotransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: BPSL1724
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p1ta_
  • Chain 'B':
    Compound: Putative histidinol-phosphate aminotransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: BPSL1724
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p1tb_
  • Chain 'C':
    Compound: Putative histidinol-phosphate aminotransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: BPSL1724
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p1tc_
  • Chain 'D':
    Compound: Putative histidinol-phosphate aminotransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: BPSL1724
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p1td_
  • Heterogens: SO4, TLA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p1tA (A:)
    gmsvgeamdtevraaaqavclafnenpeaveprvqaaiaaaaarinrypfdaeprvmrkl
    aehfscpednlmlvrgidecfdrisaefssmrfvtawpgfdgyrariavsglrhfeiglt
    ddllldpndlaqvsrddcvvlanpsnptgqalsageldqlrqragkllidetyvdyssfr
    arglaygenelvfrsfsksyglaglrlgalfgpseliaamkrkqwfcnvgtldlhaleaa
    ldndrareahiaktlaqrrrvadalrglgyrvasseanfvlvenaagertlrflrergiq
    vkdagqfglhhhirisigreedndrllaalaeysdhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1tA (A:)
    aaaqavclafnenpeaveprvqaaiaaaaarinrypfdaeprvmrklaehfscpednlml
    vrgidecfdrisaefssmrfvtawpgfdgyrariavsglrhfeigltddllldpndlaqv
    srddcvvlanpsnptgqalsageldqlrqragkllidetyvdyssfrarglaygenelvf
    rsfsksyglaglrlgalfgpseliaamkrkqwfcnvgtldlhaleaaldndrareahiak
    tlaqrrrvadalrglgyrvasseanfvlvenaagertlrflrergiqvkdagqfglhhhi
    risigreedndrllaalaeysd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p1tB (B:)
    gmsvgeamdtevraaaqavclafnenpeaveprvqaaiaaaaarinrypfdaeprvmrkl
    aehfscpednlmlvrgidecfdrisaefssmrfvtawpgfdgyrariavsglrhfeiglt
    ddllldpndlaqvsrddcvvlanpsnptgqalsageldqlrqragkllidetyvdyssfr
    arglaygenelvfrsfsksyglaglrlgalfgpseliaamkrkqwfcnvgtldlhaleaa
    ldndrareahiaktlaqrrrvadalrglgyrvasseanfvlvenaagertlrflrergiq
    vkdagqfglhhhirisigreedndrllaalaeysdhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1tB (B:)
    avclafnenpeaveprvqaaiaaaaarinrypfdaeprvmrklaehfscpednlmlvrgi
    decfdrisaefssmrfvtawpgfdgyrariavsglrhfeigltddllldpndlaqvsrdd
    cvvlanpsnptgqalsageldqlrqragkllidetyvdyssfrarglaygenelvfrsfs
    ksyglaglrlgalfgpseliaamkrkqwfcnvgtldlhaleaaldndrareahiaktlaq
    rrrvadalrglgyrvasseanfvlvenaagertlrflrergiqvkdagqfglhhhirisi
    greedndrllaalaeysdh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p1tC (C:)
    gmsvgeamdtevraaaqavclafnenpeaveprvqaaiaaaaarinrypfdaeprvmrkl
    aehfscpednlmlvrgidecfdrisaefssmrfvtawpgfdgyrariavsglrhfeiglt
    ddllldpndlaqvsrddcvvlanpsnptgqalsageldqlrqragkllidetyvdyssfr
    arglaygenelvfrsfsksyglaglrlgalfgpseliaamkrkqwfcnvgtldlhaleaa
    ldndrareahiaktlaqrrrvadalrglgyrvasseanfvlvenaagertlrflrergiq
    vkdagqfglhhhirisigreedndrllaalaeysdhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1tC (C:)
    aaqavclafnenpeaveprvqaaiaaaaarinrypfdaeprvmrklaehfscpednlmlv
    rgidecfdrisaefssmrfvtawpgfdgyrariavsglrhfeigltddllldpndlaqvs
    rddcvvlanpsnptgqalsageldqlrqragkllidetyvdyssfrarglaygenelvfr
    sfsksyglaglrlgalfgpseliaamkrkqwfcnvgtldlhaleaaldndrareahiakt
    laqrrrvadalrglgyrvasseanfvlvenaagertlrflrergiqvkdagqfglhhhir
    isigreedndrllaalaeysd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p1tD (D:)
    gmsvgeamdtevraaaqavclafnenpeaveprvqaaiaaaaarinrypfdaeprvmrkl
    aehfscpednlmlvrgidecfdrisaefssmrfvtawpgfdgyrariavsglrhfeiglt
    ddllldpndlaqvsrddcvvlanpsnptgqalsageldqlrqragkllidetyvdyssfr
    arglaygenelvfrsfsksyglaglrlgalfgpseliaamkrkqwfcnvgtldlhaleaa
    ldndrareahiaktlaqrrrvadalrglgyrvasseanfvlvenaagertlrflrergiq
    vkdagqfglhhhirisigreedndrllaalaeysdhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1tD (D:)
    avclafnenpeaveprvqaaiaaaaarinrypfdaeprvmrklaehfscpednlmlvrgi
    decfdrisaefssmrfvtawpgfdgyrariavsglrhfeigltddllldpndlaqvsrdd
    cvvlanpsnptgqalsageldqlrqragkllidetyvdyssfrarglaygenelvfrsfs
    ksyglaglrlgalfgpseliaamkrkqwfcnvgtldlhaleaaldndrareahiaktlaq
    rrrvadalrglgyrvasseanfvlvenaagertlrflrergiqvkdagqfglhhhirisi
    greedndrllaalaeys