PDB entry 3p1q

View 3p1q on RCSB PDB site
Description: Crystal structure of human 14-3-3 sigma C38N/N166H in complex with TASK-3 Peptide and stabilizer fusicoccin A
Class: peptide binding protein
Keywords: Helical protein, Phosphoprotein, Adapter protein, Peptide binding protein, Nucleus
Deposited on 2010-09-30, released 2011-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
      • engineered mutation (42)
      • engineered mutation (170)
    Domains in SCOPe 2.08: d3p1qa1, d3p1qa2
  • Chain 'P':
    Compound: 6-mer peptide from Potassium channel subfamily K member 9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FSC, CL, MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3p1qA (A:)
gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsneernllsvayknvvggq
raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkemppthpirlglaln
fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

  • Chain 'P':
    No sequence available.