PDB entry 3p1d

View 3p1d on RCSB PDB site
Description: Crystal structure of the bromodomain of human CREBBP in complex with N-Methyl-2-pyrrolidone (NMP)
Class: transcription
Keywords: Structural Genomics Consortium, SGC, CBP, CREBBP, CREB binding protein isoform a, KAT3A, RSTS, RST, bromodomain, TRANSCRIPTION
Deposited on 2010-09-30, released 2010-11-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.17
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Crebbp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3p1da_
  • Chain 'B':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Crebbp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3p1db_
  • Heterogens: SCN, MB3, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p1dA (A:)
    smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
    krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1dA (A:)
    kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
    dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p1dB (B:)
    smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
    krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1dB (B:)
    kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
    dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl