PDB entry 3p0y

View 3p0y on RCSB PDB site
Description: anti-EGFR/HER3 Fab DL11 in complex with domain III of EGFR extracellular region
Class: immune system
Keywords: beta-sandwich, antigens EGFR, IMMUNE SYSTEM
Deposited on 2010-09-29, released 2011-10-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3p0ya1, d3p0ya2
  • Chain 'H':
    Compound: Fab DL11 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3P0Y (0-End)
  • Chain 'L':
    Compound: Fab DL11 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3P0Y (0-End)
    Domains in SCOPe 2.04: d3p0yl1, d3p0yl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p0yA (A:)
    rkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeld
    ilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrsl
    keisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcspe
    gcwgpeprdcvscrnvsrgrecvdkgnshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0yA (A:)
    rkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeld
    ilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrsl
    keisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcspe
    gcwgpeprdcvscr
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3p0yL (L:)
    diqmtqspsslsasvgdrvtitcrasqdlatdvawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsepepytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0yL (L:)
    diqmtqspsslsasvgdrvtitcrasqdlatdvawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsepepytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge