PDB entry 3p0v

View 3p0v on RCSB PDB site
Description: anti-EGFR/HER3 Fab DL11 alone
Class: immune system
Keywords: beta-sandwich, immune system, antigens EGFR and HER3
Deposited on 2010-09-29, released 2011-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.23
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab DL11 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3P0V (0-End)
  • Chain 'I':
    Compound: Fab DL11 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3P0V (0-End)
  • Chain 'L':
    Compound: Fab DL11 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3P0V (0-End)
    Domains in SCOPe 2.06: d3p0vl1, d3p0vl2
  • Chain 'M':
    Compound: Fab DL11 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3P0V (0-End)
    Domains in SCOPe 2.06: d3p0vm1, d3p0vm2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3p0vL (L:)
    diqmtqspsslsasvgdrvtitcrasqdlatdvawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsepepytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0vL (L:)
    diqmtqspsslsasvgdrvtitcrasqdlatdvawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsepepytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3p0vM (M:)
    diqmtqspsslsasvgdrvtitcrasqdlatdvawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsepepytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0vM (M:)
    diqmtqspsslsasvgdrvtitcrasqdlatdvawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsepepytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg