PDB entry 3p0d

View 3p0d on RCSB PDB site
Description: Crystal structure of a multimodular ternary protein complex from Clostridium thermocellum
Class: hydrolase
Keywords: Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Cohesin, Dockerin, X-module, Cellulosome, HYDROLASE
Deposited on 2010-09-28, released 2011-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.187
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 9
    Species: Clostridium thermocellum JW20 [TaxId:492476]
    Gene: Cther_2220
    Database cross-references and differences (RAF-indexed):
    • Uniprot D1NID1 (22-87)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d3p0da1, d3p0da2
  • Chain 'B':
    Compound: scaffolding dockerin binding protein a
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: SdbA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p0db_
  • Chain 'C':
    Compound: Cellulosome anchoring protein cohesin region
    Species: Clostridium thermocellum DSM 2360 [TaxId:572545]
    Gene: ClothDRAFT_2952
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Glycoside hydrolase family 9
    Species: Clostridium thermocellum JW20 [TaxId:492476]
    Gene: Cther_2220
    Database cross-references and differences (RAF-indexed):
    • Uniprot D1NID1 (22-87)
      • expression tag (21)
    Domains in SCOPe 2.07: d3p0dd1, d3p0dd2
  • Chain 'E':
    Compound: scaffolding dockerin binding protein a
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: SdbA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p0de_
  • Chain 'F':
    Compound: Cellulosome anchoring protein cohesin region
    Species: Clostridium thermocellum DSM 2360 [TaxId:572545]
    Gene: ClothDRAFT_2952
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Glycoside hydrolase family 9
    Species: Clostridium thermocellum JW20 [TaxId:492476]
    Gene: Cther_2220
    Database cross-references and differences (RAF-indexed):
    • Uniprot D1NID1 (22-End)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d3p0dg1, d3p0dg2
  • Chain 'H':
    Compound: scaffolding dockerin binding protein a
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: SdbA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p0dh_
  • Chain 'I':
    Compound: Cellulosome anchoring protein cohesin region
    Species: Clostridium thermocellum DSM 2360 [TaxId:572545]
    Gene: ClothDRAFT_2952
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Glycoside hydrolase family 9
    Species: Clostridium thermocellum JW20 [TaxId:492476]
    Gene: Cther_2220
    Database cross-references and differences (RAF-indexed):
    • Uniprot D1NID1 (22-End)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d3p0dj1, d3p0dj2
  • Chain 'K':
    Compound: scaffolding dockerin binding protein a
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: SdbA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p0dk_
  • Chain 'L':
    Compound: Cellulosome anchoring protein cohesin region
    Species: Clostridium thermocellum DSM 2360 [TaxId:572545]
    Gene: ClothDRAFT_2952
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p0dA (A:)
    mghhhhhhhhhhssghiegrhmgdvnddgkvnstdltllkryvlkavstlpsskaeknad
    vnrdgrvnssdvtilsrylirvieklpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0dA (A:)
    hmgdvnddgkvnstdltllkryvlkavstlpsskaeknadvnrdgrvnssdvtilsryli
    rvieklpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p0dB (B:)
    mrgshhhhhhtdlradkassielkfdrnkgevgdiligtvrinniknfagfqvnivydpk
    vlmavdpetgkeftsstfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyket
    gvaeesgiiakigfkilqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvl
    slgdepy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0dB (B:)
    assielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftsst
    fppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfkil
    qkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p0dD (D:)
    mghhhhhhhhhhssghiegrhmgdvnddgkvnstdltllkryvlkavstlpsskaeknad
    vnrdgrvnssdvtilsrylirvieklpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0dD (D:)
    mgdvnddgkvnstdltllkryvlkavstlpsskaeknadvnrdgrvnssdvtilsrylir
    vieklpi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3p0dE (E:)
    mrgshhhhhhtdlradkassielkfdrnkgevgdiligtvrinniknfagfqvnivydpk
    vlmavdpetgkeftsstfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyket
    gvaeesgiiakigfkilqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvl
    slgdepy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0dE (E:)
    kassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftss
    tfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfki
    lqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3p0dG (G:)
    mghhhhhhhhhhssghiegrhmgdvnddgkvnstdltllkryvlkavstlpsskaeknad
    vnrdgrvnssdvtilsrylirvieklpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0dG (G:)
    hmgdvnddgkvnstdltllkryvlkavstlpsskaeknadvnrdgrvnssdvtilsryli
    rvieklp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3p0dH (H:)
    mrgshhhhhhtdlradkassielkfdrnkgevgdiligtvrinniknfagfqvnivydpk
    vlmavdpetgkeftsstfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyket
    gvaeesgiiakigfkilqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvl
    slgdepy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0dH (H:)
    assielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftsst
    fppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfkil
    qkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3p0dJ (J:)
    mghhhhhhhhhhssghiegrhmgdvnddgkvnstdltllkryvlkavstlpsskaeknad
    vnrdgrvnssdvtilsrylirvieklpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0dJ (J:)
    hmgdvnddgkvnstdltllkryvlkavstlpsskaeknadvnrdgrvnssdvtilsryli
    rviekl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3p0dK (K:)
    mrgshhhhhhtdlradkassielkfdrnkgevgdiligtvrinniknfagfqvnivydpk
    vlmavdpetgkeftsstfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyket
    gvaeesgiiakigfkilqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvl
    slgdepy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0dK (K:)
    assielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdptgkeftsstf
    ppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfkilq
    kkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl
    

  • Chain 'L':
    No sequence available.