PDB entry 3p05

View 3p05 on RCSB PDB site
Description: X-ray structure of pentameric HIV-1 CA
Class: viral protein
Keywords: capsid protein, VIRAL PROTEIN
Deposited on 2010-09-27, released 2011-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.232
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 ca
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: CA, gag
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497 (0-End)
      • engineered mutation (20-21)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d3p05a1, d3p05a2
  • Chain 'B':
    Compound: hiv-1 ca
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: CA, gag
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497 (0-End)
      • engineered mutation (20-21)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d3p05b1, d3p05b2
  • Chain 'C':
    Compound: hiv-1 ca
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: CA, gag
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497 (0-End)
      • engineered mutation (20-21)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d3p05c1, d3p05c2
  • Chain 'D':
    Compound: hiv-1 ca
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: CA, gag
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497 (0-End)
      • engineered mutation (20-21)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d3p05d1
  • Chain 'E':
    Compound: hiv-1 ca
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: CA, gag
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497 (0-End)
      • engineered mutation (20-21)
      • engineered mutation (183-184)
    Domains in SCOPe 2.07: d3p05e1, d3p05e2
  • Heterogens: IOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p05A (A:)
    pivqnlqgqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p05A (A:)
    pihqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqml
    ketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipvgei
    ykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknaatetl
    lvqnanpdcktilkalgpgatleemmtacq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p05B (B:)
    pivqnlqgqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p05B (B:)
    pivqnlqgqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpmreprgsdiagttstlqeqigwmthnppipvgeiy
    krwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknaatetll
    vqnanpdcktilkalgpgatleemmtacq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p05C (C:)
    pivqnlqgqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p05C (C:)
    pivqnlqgqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpmreprgsdiagttstlqeqigwmthnppipvgeiy
    krwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknaatetll
    vqnanpdcktilkalgpgatleemmtacq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p05D (D:)
    pivqnlqgqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p05D (D:)
    pivqnqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvgghq
    aamqmlketineeaaewdrlhpmreprgsdiagttstlqeqigwmthnppipvgeiykrw
    iilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqn
    anpdcktilkalgpgatleemmtacq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3p05E (E:)
    pivqnlqgqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p05E (E:)
    pihqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqml
    ketineeaaewdrlhpreprgsdiagttstlqeqigwmthnppipvgeiykrwiilglnk
    ivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdckt
    ilkalgpgatleemmtacq