PDB entry 3ozw

View 3ozw on RCSB PDB site
Description: The Crystal Structure of flavohemoglobin from R. eutrophus in complex with ketoconazole
Class: lipid binding protein
Keywords: globin fold, antiparallel beta-barrel, alpha/beta fold, HEM-, FAD-, NAD- binding domains, LIPID BINDING PROTEIN
Deposited on 2010-09-27, released 2011-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flavohemoglobin
    Species: Ralstonia eutropha [TaxId:381666]
    Gene: hmp, fhp, PHG200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ozwa1, d3ozwa2, d3ozwa3
  • Chain 'B':
    Compound: Flavohemoglobin
    Species: Ralstonia eutropha [TaxId:381666]
    Gene: hmp, fhp, PHG200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ozwb1, d3ozwb2, d3ozwb3
  • Heterogens: HEM, FAD, KKK, DGG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ozwA (A:)
    mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara
    vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis
    awaqaygnladvlmgmeselyersaeqpggwkgwrtfvirekrpesdvitsfilepadgg
    pvvnfepgqytsvaidvpalglqqirqyslsdmpngrsyrisvkregggpqppgyvsnll
    hdhvnvgdqvklaapygsfhidvdaktpivlisggvgltpmvsmlkvalqapprqvvfvh
    garnsavhamrdrlreaaktyenldlfvfydqplpedvqgrdydypglvdvkqieksill
    pdadyyicgpipfmrmqhdalknlgihearihyevfgpdlfae
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ozwB (B:)
    mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara
    vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis
    awaqaygnladvlmgmeselyersaeqpggwkgwrtfvirekrpesdvitsfilepadgg
    pvvnfepgqytsvaidvpalglqqirqyslsdmpngrsyrisvkregggpqppgyvsnll
    hdhvnvgdqvklaapygsfhidvdaktpivlisggvgltpmvsmlkvalqapprqvvfvh
    garnsavhamrdrlreaaktyenldlfvfydqplpedvqgrdydypglvdvkqieksill
    pdadyyicgpipfmrmqhdalknlgihearihyevfgpdlfae