PDB entry 3oy8

View 3oy8 on RCSB PDB site
Description: Crystal structure of human galectin-1 in complex with lactobionic acid
Class: carbohydrate binding protein
Keywords: Carbohydrate binding protein, Galectin, Lactobionic acid
Deposited on 2010-09-23, released 2010-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3oy8a_
  • Chain 'B':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3oy8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oy8A (A:)
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oy8B (B:)
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd