PDB entry 3oy4

View 3oy4 on RCSB PDB site
Description: Crystal Structure of HIV-1 L76V Protease in Complex with the Protease Inhibitor Darunavir.
Class: Hydrolase/Hydrolase Inhibitor
Keywords: HIV-1 protease, inhibitor resistance, AIDS, Aspartyl protease, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2010-09-22, released 2011-02-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1 [TaxId:11685]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered mutation (6)
    • conflict (63)
    • engineered mutation (75)
  Domains in SCOPe 2.06: d3oy4a_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1 [TaxId:11685]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered mutation (6)
    • conflict (63)
    • engineered mutation (75)
  Domains in SCOPe 2.06: d3oy4b_
• Heterogens: PO4, ACT, 017, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3oy4A (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvvvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3oy4B (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvvvgptpvniigrnlltqigctlnf