PDB entry 3oy4
View 3oy4 on RCSB PDB site
Description: Crystal Structure of HIV-1 L76V Protease in Complex with the Protease Inhibitor Darunavir.
Class: Hydrolase/Hydrolase Inhibitor
Keywords: HIV-1 protease, inhibitor resistance, AIDS, Aspartyl protease, Hydrolase-Hydrolase Inhibitor complex
Deposited on
2010-09-22, released
2011-02-09
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-02-09, with a file datestamp of
2011-02-04.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.18
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered mutation (6)
- conflict (63)
- engineered mutation (75)
Domains in SCOPe 2.06: d3oy4a_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered mutation (6)
- conflict (63)
- engineered mutation (75)
Domains in SCOPe 2.06: d3oy4b_ - Heterogens: PO4, ACT, 017, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3oy4A (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvvvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3oy4B (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvvvgptpvniigrnlltqigctlnf