PDB entry 3oy4

View 3oy4 on RCSB PDB site
Description: Crystal Structure of HIV-1 L76V Protease in Complex with the Protease Inhibitor Darunavir.
Class: Hydrolase/Hydrolase Inhibitor
Keywords: HIV-1 protease, inhibitor resistance, AIDS, Aspartyl protease, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2010-09-22, released 2011-02-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • conflict (63)
      • engineered mutation (75)
    Domains in SCOPe 2.04: d3oy4a_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • conflict (63)
      • engineered mutation (75)
    Domains in SCOPe 2.04: d3oy4b_
  • Heterogens: PO4, ACT, 017, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oy4A (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvvvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oy4B (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvvvgptpvniigrnlltqigctlnf