PDB entry 3oy3

View 3oy3 on RCSB PDB site
Description: Crystal structure of ABL T315I mutant kinase domain bound with a DFG-out inhibitor AP24589
Class: transferase/transferase inhibitor
Keywords: Protein-inhibitor complex, Protein kinase two-domain fold, phosphotransferase, ATP binding, phosphorylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-09-22, released 2010-12-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.22
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: Abl1, Abl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (1-283)
      • expression tag (0)
      • engineered mutation (87)
    Domains in SCOPe 2.04: d3oy3a_
  • Chain 'B':
    Compound: Tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: Abl1, Abl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (1-283)
      • expression tag (0)
      • engineered mutation (87)
    Domains in SCOPe 2.04: d3oy3b_
  • Heterogens: XY3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oy3A (A:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oy3B (B:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg