PDB entry 3oxx

View 3oxx on RCSB PDB site
Description: Crystal Structure of HIV-1 I50V, A71V Protease in Complex with the Protease Inhibitor Atazanavir
Class: Hydrolase/Hydrolase Inhibitor
Keywords: HIV-1 protease, inhibitor resistance, AIDS, Aspartyl protease, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2010-09-22, released 2011-09-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.175
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (49)
      • engineered mutation (70)
    Domains in SCOPe 2.04: d3oxxa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (49)
      • engineered mutation (70)
    Domains in SCOPe 2.04: d3oxxb_
  • Chain 'C':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (49)
      • engineered mutation (70)
    Domains in SCOPe 2.04: d3oxxc_
  • Chain 'D':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (49)
      • engineered mutation (70)
    Domains in SCOPe 2.04: d3oxxd_
  • Heterogens: GOL, EDO, ACT, DR7, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oxxA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
    qipveicghkvigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oxxB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
    qipveicghkvigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oxxC (C:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
    qipveicghkvigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oxxD (D:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
    qipveicghkvigtvlvgptpvniigrnlltqigctlnf