PDB entry 3oxx
View 3oxx on RCSB PDB site
Description: Crystal Structure of HIV-1 I50V, A71V Protease in Complex with the Protease Inhibitor Atazanavir
Class: Hydrolase/Hydrolase Inhibitor
Keywords: HIV-1 protease, inhibitor resistance, AIDS, Aspartyl protease, Hydrolase-Hydrolase Inhibitor complex
Deposited on
2010-09-22, released
2011-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-11-08, with a file datestamp of
2017-11-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered mutation (6)
- engineered mutation (49)
- engineered mutation (70)
Domains in SCOPe 2.08: d3oxxa_ - Chain 'B':
Compound: hiv-1 protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered mutation (6)
- engineered mutation (49)
- engineered mutation (70)
Domains in SCOPe 2.08: d3oxxb_ - Chain 'C':
Compound: hiv-1 protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered mutation (6)
- engineered mutation (49)
- engineered mutation (70)
Domains in SCOPe 2.08: d3oxxc_ - Chain 'D':
Compound: hiv-1 protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered mutation (6)
- engineered mutation (49)
- engineered mutation (70)
Domains in SCOPe 2.08: d3oxxd_ - Heterogens: GOL, EDO, ACT, DR7, PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3oxxA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipveicghkvigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3oxxB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipveicghkvigtvlvgptpvniigrnlltqigctlnf
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3oxxC (C:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipveicghkvigtvlvgptpvniigrnlltqigctlnf
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3oxxD (D:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipveicghkvigtvlvgptpvniigrnlltqigctlnf