PDB entry 3oxv

View 3oxv on RCSB PDB site
Description: Crystal Structure of HIV-1 I50V, A71 Protease in Complex with the protease inhibitor amprenavir.
Class: Hydrolase/Hydrolase Inhibitor
Keywords: HIV-1 protease, inhibitor resistance, AIDS, Aspartyl protease, drug resistance, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2010-09-22, released 2011-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (49)
      • conflict (63)
      • engineered mutation (70)
    Domains in SCOPe 2.08: d3oxva_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (49)
      • conflict (63)
      • engineered mutation (70)
    Domains in SCOPe 2.08: d3oxvb_
  • Chain 'C':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (49)
      • conflict (63)
      • engineered mutation (70)
    Domains in SCOPe 2.08: d3oxvc_
  • Chain 'D':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (49)
      • conflict (63)
      • engineered mutation (70)
    Domains in SCOPe 2.08: d3oxvd_
  • Heterogens: 478, PO4, GOL, ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oxvA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipieicghkvigtvlvgptpvniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oxvB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipieicghkvigtvlvgptpvniigrnlltqigctlnf

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oxvC (C:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipieicghkvigtvlvgptpvniigrnlltqigctlnf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oxvD (D:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipieicghkvigtvlvgptpvniigrnlltqigctlnf