PDB entry 3oxn

View 3oxn on RCSB PDB site
Description: The crystal structure of a putative transcriptional regulator from Vibrio parahaemolyticus
Class: transcription regulator
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, putative transcriptional regulator, PSI, SGX, TRANSCRIPTION REGULATOR
Deposited on 2010-09-21, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.248
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcriptional regulator, LysR family
    Species: Vibrio parahaemolyticus [TaxId:670]
    Gene: VP0027
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oxna_
  • Chain 'B':
    Compound: Putative transcriptional regulator, LysR family
    Species: Vibrio parahaemolyticus [TaxId:670]
    Gene: VP0027
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oxnb_
  • Chain 'C':
    Compound: Putative transcriptional regulator, LysR family
    Species: Vibrio parahaemolyticus [TaxId:670]
    Gene: VP0027
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oxnc_
  • Chain 'D':
    Compound: Putative transcriptional regulator, LysR family
    Species: Vibrio parahaemolyticus [TaxId:670]
    Gene: VP0027
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oxnd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oxnA (A:)
    mslrqllspvefdpqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrl
    sdqltyegadlaicrptgpveplrseilgrvgvlcllskqhplanqemslddylshpham
    iaisdgvkalieqalidkpqrkmvlrayhleaalaivdtlpiiitvpadlaylvaerydl
    vvkplpfqftpfdysmiwharcehspaqewlrsvvreecsrliakriedmglneghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oxnA (A:)
    pqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrlsdqltyegadlai
    crptgpveplrseilgrvgvlcllskqhplanqemslddylshphamiaisdgvkalieq
    alidkpqrkmvlrayhleaalaivlpiiitvpadlaylvaerydlvvkplpfqftpfdys
    miwharcehspaqewlrsvvreecsrliakrie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3oxnB (B:)
    mslrqllspvefdpqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrl
    sdqltyegadlaicrptgpveplrseilgrvgvlcllskqhplanqemslddylshpham
    iaisdgvkalieqalidkpqrkmvlrayhleaalaivdtlpiiitvpadlaylvaerydl
    vvkplpfqftpfdysmiwharcehspaqewlrsvvreecsrliakriedmglneghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oxnB (B:)
    dpqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrlsdqltyegadla
    icrptgpveplrseilgrvgvlcllskqhplanqemslddylshphamiaisdgvkalie
    qalidkpqrkmvlrayhleaalaivdtlpiiitvpadlaylvaerydlvvkplpfqftpf
    dysmiwharcehspaqewlrsvvreecsrliakri
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3oxnC (C:)
    mslrqllspvefdpqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrl
    sdqltyegadlaicrptgpveplrseilgrvgvlcllskqhplanqemslddylshpham
    iaisdgvkalieqalidkpqrkmvlrayhleaalaivdtlpiiitvpadlaylvaerydl
    vvkplpfqftpfdysmiwharcehspaqewlrsvvreecsrliakriedmglneghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oxnC (C:)
    fdpqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrlsdqltyegadl
    aicrptveplrseilgrvgvlcllskqhplanqemslddylshphamiaisdgvkalieq
    alidkpqrkmvlrayhleaalaivdtlpiiitvpadlaylvaerydlvvkplpfqftpfd
    ysmiwharcehspaqewlrsvvreecsrliakr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3oxnD (D:)
    mslrqllspvefdpqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrl
    sdqltyegadlaicrptgpveplrseilgrvgvlcllskqhplanqemslddylshpham
    iaisdgvkalieqalidkpqrkmvlrayhleaalaivdtlpiiitvpadlaylvaerydl
    vvkplpfqftpfdysmiwharcehspaqewlrsvvreecsrliakriedmglneghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oxnD (D:)
    pqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrlsdqltyegadlai
    crptgpveplrseilgrvgvlcllskqhplanqemslddylshphamiaisdgvkalieq
    alidkpqrkmvlrayhleaalaivdtlpiiitvpadlaylvaerydlvvkplpfqftpfd
    ysmiwharcehspaqewlrsvvreecsrliak