PDB entry 3owf

View 3owf on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V66R at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdtp, domain swapping
Deposited on 2010-09-17, released 2010-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.181
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-End)
      • engineered mutation (43-44)
      • engineered mutation (59)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d3owfa_
  • Heterogens: THP, CA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3owfA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmr
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3owfA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmr
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniws