PDB entry 3owd

View 3owd on RCSB PDB site
Description: Crystal Structure of HSP90 with N-Aryl-benzimidazolone II
Class: chaperone
Keywords: hsp90, chaperone
Deposited on 2010-09-17, released 2011-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.167
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (0-206)
      • conflict (46)
    Domains in SCOPe 2.07: d3owda_
  • Heterogens: MEY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3owdA (A:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfve