PDB entry 3ow4

View 3ow4 on RCSB PDB site
Description: Discovery of dihydrothieno- and dihydrofuropyrimidines as potent pan Akt inhibitors
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: SERINE-THREONINE KINASE, TRANSFERASE, TRANSFERASE-TRANSFERASE inhibitor complex
Deposited on 2010-09-17, released 2010-11-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.197
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAC-alpha serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT1, PKB, RAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31749 (4-End)
      • engineered mutation (333)
      • see remark 999 (338)
    Domains in SCOPe 2.04: d3ow4a_
  • Chain 'B':
    Compound: RAC-alpha serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT1, PKB, RAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31749 (4-End)
      • engineered mutation (333)
      • see remark 999 (338)
    Domains in SCOPe 2.04: d3ow4b_
  • Chain 'C':
    Compound: GSK 3 beta peptide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3OW4 (0-9)
  • Chain 'D':
    Compound: GSK 3 beta peptide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3OW4 (0-9)
  • Heterogens: SMY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ow4A (A:)
    gamarvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtlten
    rvlqnsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivs
    aldylhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylape
    vledndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksl
    lsgllkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfd
    eeftaqmititppdqddsmecvdserrphfpqfdysassta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ow4A (A:)
    rvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtltenrvlq
    nsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivsaldy
    lhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylapevled
    ndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksllsgl
    lkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfdeeft
    aqmitrphfpqfdysass
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ow4B (B:)
    gamarvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtlten
    rvlqnsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivs
    aldylhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylape
    vledndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksl
    lsgllkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfd
    eeftaqmititppdqddsmecvdserrphfpqfdysassta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ow4B (B:)
    rvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtltenrvlq
    nsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivsaldy
    lhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylapevled
    ndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksllsgl
    lkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfdeeft
    aqmitrphfpqfdysass
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.