PDB entry 3ovq

View 3ovq on RCSB PDB site
Description: Crytal Structure of hRPE and D-Ribulose-5-Phospate Complex
Class: Isomerase
Keywords: D-Ribulose-5-Phosphate, Isomerase
Deposited on 2010-09-17, released 2011-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.149
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose-phosphate 3-epimerase
    Species: Homo sapiens [TaxId:9606]
    Gene: RPE, HUSSY-17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ovqa_
  • Chain 'B':
    Compound: ribulose-phosphate 3-epimerase
    Species: Homo sapiens [TaxId:9606]
    Gene: RPE, HUSSY-17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ovqb_
  • Heterogens: FE2, 5RP, XPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ovqA (A:)
    masgckigpsilnsdlanlgaeclrmldsgadylhldvmdghfvpnitfghpvveslrkq
    lgqdpffdmhmmvskpeqwvkpmavaganqytfhleatenpgalikdirengmkvglaik
    pgtsveylapwanqidmalvmtvepgfggqkfmedmmpkvhwlrtqfpsldievdggvgp
    dtvhkcaeaganmivsgsaimrsedprsvinllrnvcseaaqkrsldr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ovqA (A:)
    gckigpsilnsdlanlgaeclrmldsgadylhldvmdghfvpnitfghpvveslrkqlgq
    dpffdmhmmvskpeqwvkpmavaganqytfhleatenpgalikdirengmkvglaikpgt
    sveylapwanqidmalvmtvepgfggqkfmedmmpkvhwlrtqfpsldievdggvgpdtv
    hkcaeaganmivsgsaimrsedprsvinllrnvcseaaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ovqB (B:)
    masgckigpsilnsdlanlgaeclrmldsgadylhldvmdghfvpnitfghpvveslrkq
    lgqdpffdmhmmvskpeqwvkpmavaganqytfhleatenpgalikdirengmkvglaik
    pgtsveylapwanqidmalvmtvepgfggqkfmedmmpkvhwlrtqfpsldievdggvgp
    dtvhkcaeaganmivsgsaimrsedprsvinllrnvcseaaqkrsldr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ovqB (B:)
    ckigpsilnsdlanlgaeclrmldsgadylhldvmdghfvpnitfghpvveslrkqlgqd
    pffdmhmmvskpeqwvkpmavaganqytfhleatenpgalikdirengmkvglaikpgts
    veylapwanqidmalvmtvepgfggqkfmedmmpkvhwlrtqfpsldievdggvgpdtvh
    kcaeaganmivsgsaimrsedprsvinllrnvcseaaqk