PDB entry 3ovo

View 3ovo on RCSB PDB site
Description: refined x-ray crystal structures of the reactive site modified ovomucoid inhibitor third domains from silver pheasant (omsvp3(asterisk)) and from japanese quail (omjpq3(asterisk))
Deposited on 1991-05-13, released 1993-01-15
The last revision prior to the SCOP 1.67 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.55 Å
R-factor: 0.192
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d3ovo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ovo_ (-)
    laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc