PDB entry 3ov6

View 3ov6 on RCSB PDB site
Description: CD1c in complex with MPM (mannosyl-beta1-phosphomycoketide)
Class: immune system
Keywords: MHC, Immunoglobulin Domain, Immune System, Antigen Presentation
Deposited on 2010-09-15, released 2011-01-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin, T-cell surface glycoprotein CD1c, T-cell surface glycoprotein CD1b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (3-101)
      • expression tag (2)
      • linker (102-105)
    • Uniprot P29017 (Start-299)
      • engineered mutation (168)
      • engineered mutation (173)
      • engineered mutation (224)
      • engineered mutation (244)
    • Uniprot P29016 (300-394)
      • engineered mutation (357-358)
      • expression tag (395-396)
    Domains in SCOPe 2.04: d3ov6a1, d3ov6a2, d3ov6a3
  • Heterogens: NAG, D12, MK0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ov6A (A:)
    adpiqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfs
    kdwsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdmggggsggsgsgggssada
    sqehvsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhqwskgqfsneel
    sdlellfrfylfgltreiqdhasqdyskypfevqvkagcelhsggspegffqvafngldl
    lsfqqttwvpspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvh
    rqvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnaqgt
    wylratldvadgeaaglscrvkhsslegqdiilywhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ov6A (A:)
    piqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdmggggehvsfhviqifsfvnq
    swargqgsgwldelqthgwdsesgtiiflhqwskgqfsneelsdlellfrfylfgltrei
    qdhasskypfevqvkagcelhsggspegffqvafngldllsfqqttwvpspgcgslaqsv
    chllnhqyegvtetvynlirstcprfllglldagkmyvhrqvkpeawlssgpspgpgrlq
    lvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnaqgtwylratldvadgeaaglscrv
    khsslegqdiilywhh