PDB entry 3ouz

View 3ouz on RCSB PDB site
Description: Crystal Structure of Biotin Carboxylase-ADP complex from Campylobacter jejuni
Class: ligase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta fold, Carboxylase, cytosol, LIGASE
Deposited on 2010-09-15, released 2010-10-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.152
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin carboxylase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: accC, Cj1290c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P8W7 (3-445)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d3ouza1, d3ouza2, d3ouza3, d3ouza4
  • Chain 'B':
    Compound: biotin carboxylase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: accC, Cj1290c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ouzb1, d3ouzb2, d3ouzb3
  • Heterogens: GOL, ADP, MG, FMT, SRT, MLT, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ouzA (A:)
    snameiksilianrgeialralrtikemgkkaicvyseadkdalylkyadasicigkars
    sesylnipaiiaaaeiaeadaifpgygflsenqnfveicakhnikfigpsveamnlmsdk
    skakqvmqragvpvipgsdgalagaeaakklakeigypvilkaaaggggrgmrvvenekd
    lekaywsaeseamtafgdgtmymekyiqnprhievqvigdsfgnvihvgerdcsmqrrhq
    klieespailldektrtrlhetaikaakaigyegagtfeflvdknldfyfiemntrlqve
    hcvsemvsgidiieqmikvaegyalpsqesiklnghsiecritaedsktflpspgkitky
    ippagrnvrmeshcyqdysvpayydsmigklvvwaedrnkaiakmkvaldellisgiktt
    kdfhlsmmenpdfinnnydtnylarh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ouzA (A:)
    nameiksilianrgeialralrtikemgkkaicvyseadkdalylkyadasicigkarss
    esylnipaiiaaaeiaeadaifpgygflsenqnfveicakhnikfigpsveamnlmsdks
    kakqvmqragvpvipgsdgalagaeaakklakeigypvilkaaaggggrgmrvvenekdl
    ekaywsaeseamtafgdgtmymekyiqnprhievqvigdsfgnvihvgerdcsmqrrhqk
    lieespailldektrtrlhetaikaakaigyegagtfeflvdknldfyfiemntrlqveh
    cvsemvsgidiieqmikvaegyalpsqesiklnghsiecritaedsktflpspgkitkyi
    ppagrnvrmeshcyqdysvpayydsmigklvvwaedrnkaiakmkvaldellisgikttk
    dfhlsmmenpdfinnnydtnylarh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ouzB (B:)
    snameiksilianrgeialralrtikemgkkaicvyseadkdalylkyadasicigkars
    sesylnipaiiaaaeiaeadaifpgygflsenqnfveicakhnikfigpsveamnlmsdk
    skakqvmqragvpvipgsdgalagaeaakklakeigypvilkaaaggggrgmrvvenekd
    lekaywsaeseamtafgdgtmymekyiqnprhievqvigdsfgnvihvgerdcsmqrrhq
    klieespailldektrtrlhetaikaakaigyegagtfeflvdknldfyfiemntrlqve
    hcvsemvsgidiieqmikvaegyalpsqesiklnghsiecritaedsktflpspgkitky
    ippagrnvrmeshcyqdysvpayydsmigklvvwaedrnkaiakmkvaldellisgiktt
    kdfhlsmmenpdfinnnydtnylarh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ouzB (B:)
    meiksilianrgeialralrtikemgkkaicvyseadkdalylkyadasicigkarsses
    ylnipaiiaaaeiaeadaifpgygflsenqnfveicakhnikfigpsveamnlmsdkska
    kqvmqragvpvipgsdgalagaeaakklakeigypvilkaaaggggrgmrvvenekdlek
    aywsaeseamtafgdgtmymekyiqnprhievqvigdsfgnvihvgerdcsmqrrhqkli
    eespailldektrtrlhetaikaakaigyegagtfeflvdknldfyfiemntrlqvehcv
    semvsgidiieqmikvaegyalpsqesiklnghsiecritaedsktflpspgkitkyipp
    agrnvrmeshcyqdysvpayydsmigklvvwaedrnkaiakmkvaldellisgikttkdf
    hlsmmenpdfinnnydtnylarh