PDB entry 3ouq

View 3ouq on RCSB PDB site
Description: Structure of N-terminal hexaheme fragment of GSU1996
Class: electron transport
Keywords: multiheme cytochrome c, electron transfer, Fe reduction, Geobacter sulfurreducens, cytochrome c7 (c3) fold, ELECTRON TRANSPORT
Deposited on 2010-09-15, released 2010-12-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.244
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: GSU1996
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ouqa1, d3ouqa2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ouqA (A:)
    ketknvpfklknaapvifshdihlkkynnncrichialfdlrkpkrytmldmekgkscga
    chtgmkafsvaddsqcvrchsgsarpvayrmkgageavfshevhvpmlegkcrtchsnre
    itggrnvtmaqmekgkscgachndkmaftvagncgkchkgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ouqA (A:)
    tknvpfklknaapvifshdihlkkynnncrichialfdlrkpkrytmldmekgkscgach
    tgmkafsvaddsqcvrchsgsarpvayrmkgageavfshevhvpmlegkcrtchsnreit
    ggrnvtmaqmekgkscgachndkmaftvagncgkchkgm