PDB entry 3ouo

View 3ouo on RCSB PDB site
Description: Structure of the Nucleoprotein from Rift Valley Fever Virus
Class: viral protein
Keywords: Orthogonal Bundle, Viral genomic RNA encapsidation, RNA Viral Nucleoprotein, VIRAL PROTEIN
Deposited on 2010-09-15, released 2011-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoprotein
    Species: Rift valley fever virus [TaxId:11589]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ouoa_
  • Chain 'B':
    Compound: nucleoprotein
    Species: Rift valley fever virus [TaxId:11589]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ouob_
  • Chain 'C':
    Compound: nucleoprotein
    Species: Rift valley fever virus [TaxId:11589]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ouoc_
  • Heterogens: NO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ouoA (A:)
    mdnyqelrvqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivl
    altrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagwtcqalv
    vlsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvi
    npnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqa
    yktaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ouoA (A:)
    dnyqelrvqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivla
    ltrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagwtcqalvv
    lsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvin
    pnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqay
    ktaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ouoB (B:)
    mdnyqelrvqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivl
    altrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagwtcqalv
    vlsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvi
    npnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqa
    yktaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ouoB (B:)
    dnyqelrvqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivla
    ltrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagwtcqalvv
    lsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvin
    pnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqay
    ktaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ouoC (C:)
    mdnyqelrvqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivl
    altrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagwtcqalv
    vlsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvi
    npnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqa
    yktaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ouoC (C:)
    nyqelrvqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivlal
    trgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagwtcqalvvl
    sewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvinp
    nlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqayk
    taa