PDB entry 3oun

View 3oun on RCSB PDB site
Description: Crystal structure of the FhaA FHA domain complexed with the intracellular domain of Rv3910
Class: protein binding/transferase
Keywords: peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, regulation, phosphorylation, membrane associated intracellular, PROTEIN BINDING-TRANSFERASE complex
Deposited on 2010-09-15, released 2012-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative uncharacterized protein TB39.8
  Species: Mycobacterium tuberculosis [TaxId:83332]
  Gene: Rv0020c, TB39.8
  Database cross-references and differences (RAF-indexed):
  • Uniprot P71590 (Start-156)
  Domains in SCOPe 2.08: d3ouna_
• Chain 'B':
  Compound: probable conserved transmembrane protein
  Species: Mycobacterium tuberculosis [TaxId:83332]
  Gene: MT4029, Rv3910
  Database cross-references and differences (RAF-indexed):
  • Uniprot O05435
• Heterogens: MN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3ounA (A:)
  mgssqhhhhhssglvprgshmpqgggyaepagrdydygqsgapdygqpapggysgygqgg
  ygsagtsvtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqvall
  adlnstngttvnnapvqewqladgdvirlghseiivr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3ounA (A:)
  svtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqvalladlnst
  ngttvnnapvqewqladgdvirlghseiivr
  

  
  
• Chain 'B':
  No sequence available.