PDB entry 3oui

View 3oui on RCSB PDB site
Description: PHD2-R717 with 40787422
Class: oxidoreductase
Keywords: phd2, oxidoreductase
Deposited on 2010-09-14, released 2010-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Egl nine homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EGLN1, C1orf12, PNAS-118, PNAS-137
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ouia_
  • Heterogens: ACT, FE2, 42Z, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ouiA (A:)
    spngqtkplpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgq
    lvsqksdsskdirgdkitwiegkepgcetigllmssmddlirhcngklgsykingrtkam
    vacypgngtgyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepk
    fdrllffwsdrrnphevqpayatryaitvwyfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ouiA (A:)
    palklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqdirgdkitw
    iegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgngtgyvrhvdnpr
    cvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffwsdrrnphevqpayat
    ryaitvwyfd