PDB entry 3oug

View 3oug on RCSB PDB site
Description: Crystal structure of cleaved L-aspartate-alpha-decarboxylase from Francisella tularensis
Class: lyase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, double-psi beta barrel, Aspartic alpha-decarboxylase, L-aspartate 1-carboxy-lyase (beta-alanine-forming), pantothenate biosynthesis, LYASE
Deposited on 2010-09-14, released 2010-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.172
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate 1-decarboxylase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ouga_
  • Chain 'B':
    Compound: Aspartate 1-decarboxylase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ougb_
  • Chain 'C':
    Compound: Aspartate 1-decarboxylase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ougc_
  • Chain 'E':
    Compound: Aspartate 1-decarboxylase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ouge_
  • Chain 'F':
    Compound: Aspartate 1-decarboxylase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ougf_
  • Chain 'G':
    Compound: Aspartate 1-decarboxylase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ougg_
  • Chain 'H':
    Compound: Aspartate 1-decarboxylase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ough_
  • Chain 'I':
    Compound: Aspartate 1-decarboxylase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ougi_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ougA (A:)
    snamlisvlkskisyatvtgkdlfyvgsitidseimkqaniienekvqvvnlnngerlet
    yvikgepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlktgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ougA (A:)
    mlisvlkskisyatvtgkdlfyvsitidseimkqaniienekvqvvnlnngerletyvik
    gepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ougB (B:)
    snamlisvlkskisyatvtgkdlfyvgsitidseimkqaniienekvqvvnlnngerlet
    yvikgepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlktgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ougB (B:)
    mlisvlkskisyatvtgkdlfyvsitidseimkqaniienekvqvvnlnngerletyvik
    gepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ougC (C:)
    snamlisvlkskisyatvtgkdlfyvgsitidseimkqaniienekvqvvnlnngerlet
    yvikgepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlktgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ougC (C:)
    mlisvlkskisyatvtgkdlfysitidseimkqaniienekvqvvnlnngerletyvikg
    epnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ougE (E:)
    snamlisvlkskisyatvtgkdlfyvgsitidseimkqaniienekvqvvnlnngerlet
    yvikgepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlktgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ougE (E:)
    mlisvlkskisyatvtgkdlfysitidseimkqaniienekvqvvnlnngerletyvikg
    epnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ougF (F:)
    snamlisvlkskisyatvtgkdlfyvgsitidseimkqaniienekvqvvnlnngerlet
    yvikgepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlktgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ougF (F:)
    mlisvlkskisyatvtgkdlfyvsitidseimkqaniienekvqvvnlnngerletyvik
    gepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ougG (G:)
    snamlisvlkskisyatvtgkdlfyvgsitidseimkqaniienekvqvvnlnngerlet
    yvikgepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlktgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ougG (G:)
    mlisvlkskisyatvtgkdlfyvsitidseimkqaniienekvqvvnlnngerletyvik
    gepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ougH (H:)
    snamlisvlkskisyatvtgkdlfyvgsitidseimkqaniienekvqvvnlnngerlet
    yvikgepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlktgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ougH (H:)
    mlisvlkskisyatvtgkdlfyvsitidseimkqaniienekvqvvnlnngerletyvik
    gepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3ougI (I:)
    snamlisvlkskisyatvtgkdlfyvgsitidseimkqaniienekvqvvnlnngerlet
    yvikgepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlktgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ougI (I:)
    mlisvlkskisyatvtgkdlfyvsitidseimkqaniienekvqvvnlnngerletyvik
    gepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk