PDB entry 3oue

View 3oue on RCSB PDB site
Description: Structure of C-terminal hexaheme fragment of GSU1996
Class: electron transport
Keywords: multiheme cytochrome-c, electron transfer, Fe reduction, Geobacter sulfurreducens, cytochrome c7 (c3) fold, electron transport
Deposited on 2010-09-14, released 2010-12-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.221
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: GSU1996
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ouea1, d3ouea2
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oueA (A:)
    mtppktvnfkmkgvadaafshefhlgmykcnechtklfaykagakrftmadmdkgkscga
    chngkdafssasdcgkchpglkpakltyktsvgeayfdhdihlsmfkcadchtkvfkyrk
    gsapatmadmekgkscgvchngkdafsvaddcvkchnm