PDB entry 3oua

View 3oua on RCSB PDB site
Description: MDR769 HIV-1 protease complexed with p1/p6 hepta-peptide
Class: hydrolase/peptide
Keywords: MDR HIV-1 protease, inhibitor, drug resistance, substrate envelope, HIV-1 protease, protease, p1/p6 substrate peptide, none, HYDROLASE, HYDROLASE-PEPTIDE complex
Deposited on 2010-09-14, released 2011-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • conflict (24)
      • conflict (34-35)
      • conflict (45)
    Domains in SCOPe 2.08: d3ouaa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • conflict (24)
      • conflict (34-35)
      • conflict (45)
    Domains in SCOPe 2.08: d3ouab_
  • Chain 'P':
    Compound: p1/p6 substrate peptide
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ouaA (A:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ouaB (B:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
    

  • Chain 'P':
    No sequence available.