PDB entry 3ou4
View 3ou4 on RCSB PDB site
Description: MDR769 HIV-1 protease complexed with TF/PR hepta-peptide
Class: hydrolase/peptide
Keywords: This sequence occurs naturally in humans., HIV-1 protease, protease, TF/PR substrate peptide, none, HYDROLASE, HYDROLASE-PEPTIDE complex
Deposited on
2010-09-14, released
2011-03-30
The last revision prior to the SCOPe 2.03 freeze date was dated
2011-04-20, with a file datestamp of
2011-04-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.58
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot Q000H7 (0-98)
- conflict (24)
- conflict (34-35)
- conflict (45)
Domains in SCOPe 2.03: d3ou4a_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot Q000H7 (0-98)
- conflict (24)
- conflict (34-35)
- conflict (45)
- conflict (70)
Domains in SCOPe 2.03: d3ou4b_ - Chain 'C':
Compound: TF/PR substrate peptide
Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3ou4A (A:)
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3ou4B (B:)
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghktigtvlvgptptnvigrnlmtqigctlnf
- Chain 'C':
No sequence available.