PDB entry 3ou4

View 3ou4 on RCSB PDB site
Description: MDR769 HIV-1 protease complexed with TF/PR hepta-peptide
Class: hydrolase/peptide
Keywords: This sequence occurs naturally in humans., HIV-1 protease, protease, TF/PR substrate peptide, none, HYDROLASE, HYDROLASE-PEPTIDE complex
Deposited on 2010-09-14, released 2011-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q000H7 (0-98)
    • conflict (24)
    • conflict (34-35)
    • conflict (45)
  Domains in SCOPe 2.08: d3ou4a_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q000H7 (0-98)
    • conflict (24)
    • conflict (34-35)
    • conflict (45)
    • conflict (70)
  Domains in SCOPe 2.08: d3ou4b_
• Chain 'C':
  Compound: TF/PR substrate peptide
  Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WLL9 (0-6)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ou4A (A:)
  pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ou4B (B:)
  pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghktigtvlvgptptnvigrnlmtqigctlnf
  

  
  
• Chain 'C':
  No sequence available.