PDB entry 3otq

View 3otq on RCSB PDB site
Description: Soluble Epoxide Hydrolase in complex with pyrazole antagonist
Class: hydrolase
Keywords: epoxide hydrolase, HYDROLASE
Deposited on 2010-09-13, released 2010-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epoxide hydrolase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3otqa1, d3otqa2
  • Heterogens: MZL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3otqA (A:)
    mtlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitl
    sqwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgftta
    iltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsev
    vflddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshg
    yvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygess
    appeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslnt
    pfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmh
    kvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwacksl
    grkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilik
    wldsdarnppvvskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3otqA (A:)
    raavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitlsqw
    iplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttailt
    ntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevvfl
    ddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshgyvt
    vkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygessapp
    eieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslntpfi
    panpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmhkvc
    eagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwackslgrk
    ilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilikwld
    sdarn