PDB entry 3otf

View 3otf on RCSB PDB site
Description: Structural basis for the cAMP-dependent gating in human HCN4 channel
Class: transport protein
Keywords: cyclic-nucleotide binding, TRANSPORT PROTEIN
Deposited on 2010-09-11, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3otfa_
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3otfA (A:)
    sdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplre
    eiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgv
    vsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmm
    rrafetvaldrldrigkknsillhkvqhdlnsgvfnyqen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3otfA (A:)
    dssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplree
    iinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgvv
    svltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
    rafetvaldrldrigkk