PDB entry 3ot7

View 3ot7 on RCSB PDB site
Description: Escherichia coli apo-manganese superoxide dismutase
Class: oxidoreductase
Keywords: Oxidoreductase, superoxide dismutase, manganese enzyme, metalloprotein, DNA binding
Deposited on 2010-09-10, released 2010-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: Escherichia coli [TaxId:83333]
    Gene: sodA, b3908, JW3879
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ot7a1, d3ot7a2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: Escherichia coli [TaxId:83333]
    Gene: sodA, b3908, JW3879
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ot7b1, d3ot7b2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn]
    Species: Escherichia coli [TaxId:83333]
    Gene: sodA, b3908, JW3879
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ot7c1, d3ot7c2
  • Chain 'D':
    Compound: Superoxide dismutase [Mn]
    Species: Escherichia coli [TaxId:83333]
    Gene: sodA, b3908, JW3879
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ot7d1, d3ot7d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ot7A (A:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ot7B (B:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ot7C (C:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ot7D (D:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanqdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk