PDB entry 3ot3

View 3ot3 on RCSB PDB site
Description: X-ray crystal structure of compound 22k bound to human Chk1 kinase domain
Class: transferase/transferase inhibitor
Keywords: kinase, phosphatase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-09-10, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.185
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ot3a_
  • Heterogens: 22K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ot3A (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
    lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
    hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
    refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
    lhkilvenpsaritipdikkdrwynkplkkgak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ot3A (A:)
    pfvedwdlvqtlgegagevqlavnrvteeavavkivdmenikkeicinkmlnhenvvkfy
    ghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdi
    kpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdv
    wscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenps
    aritipdikkdrwynkplkkg