PDB entry 3osx

View 3osx on RCSB PDB site
Description: Crystal Structure of Apical Domain of Insecticidal GroEL from Xenorhapdus nematophila
Class: chaperone
Keywords: alpha, beta, Apical Domain, CHAPERONE
Deposited on 2010-09-10, released 2011-10-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.205
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60 kda chaperonin
    Species: Xenorhabdus nematophila [TaxId:628]
    Gene: groEL, groL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6Y3X3 (12-197)
      • expression tag (11)
      • expression tag (198-200)
    Domains in SCOPe 2.01: d3osxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3osxA (A:)
    mrgshhhhhhgsegmqfdrgylspyfinkpesgsvelenpyillvdkkisnirellpvle
    gvakaskplviiaedvegealatlvvnnmrgivkvasvkapgfgdrrkamlqdiatltng
    tviseeiglelekatledlgqakrvvinkdtttiidgvgeegaiaarvtqirqqieests
    dydreklqervaklaggvkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3osxA (A:)
    segmqfdrgylspyfinkpesgsvelenpyillvdkkisnirellpvlegvakaskplvi
    iaedvegealatlvvnnmrgivkvasvkapgfgdrrkamlqdiatltngtviseeiglel
    ekatledlgqakrvvinkdtttiidgvgeegaiaarvtqirqqieestsdydreklqerv
    aklaggvkln