PDB entry 3osw

View 3osw on RCSB PDB site
Description: Crystal structure of PPARgamma ligand binding domain in complex with tetrabromo-bisphenol A (TBBPA)
Class: transcription
Keywords: transcription, ligand binding protein
Deposited on 2010-09-10, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.195
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oswa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oswb_
  • Heterogens: XDI, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oswA (A:)
    gshmeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviyd
    mnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldl
    ndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefa
    vkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessql
    fakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oswA (A:)
    npesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkisk
    evairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmn
    kdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsg
    drpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqv
    ikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3oswB (B:)
    gshmeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviyd
    mnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldl
    ndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefa
    vkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessql
    fakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oswB (B:)
    esadlralakhlydsyiksfpltkakarailtgkdkspfviydmnslmmgedkkevairi
    fqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvli
    segqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgll
    nvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkteh
    pllqeiyk