PDB entry 3osi

View 3osi on RCSB PDB site
Description: Crystal structure of PPARgamma ligand binding domain in complex with tetrachloro-bisphenol A (TCBPA)
Class: transcription
Keywords: transcription, ligand binding protein
Deposited on 2010-09-09, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.177
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3osia_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3osib_
  • Heterogens: XDH, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3osiA (A:)
    gshmeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviyd
    mnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldl
    ndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefa
    vkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessql
    fakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3osiA (A:)
    npesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkike
    vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
    dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
    rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
    kktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3osiB (B:)
    gshmeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviyd
    mnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldl
    ndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefa
    vkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessql
    fakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3osiB (B:)
    sadlralakhlydsyiksfpltkakarailtgkspfviydmnslmmgedkkevairifqg
    cqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvliseg
    qgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvk
    piediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktehpll
    qeiyk