PDB entry 3osh

View 3osh on RCSB PDB site
Description: Crystal Structure of The Complex of Group 1 Phospholipase A2 With Atropin At 1.5 A Resolution
Class: hydrolase
Keywords: PLA2, Hydrolase, Atropine
Deposited on 2010-09-09, released 2010-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 3
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60045 (0-118)
      • conflict (18)
      • conflict (45)
    Domains in SCOPe 2.08: d3osha_
  • Heterogens: CA, OIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oshA (A:)
    nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
    rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn